Abstract
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 µM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
Author supplied keywords
Cite
CITATION STYLE
Fan, L., Warnecke, A., Weder, J., Preller, M., & Zeilinger, C. (2022). Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site. International Journal of Molecular Sciences, 23(13). https://doi.org/10.3390/ijms23137150
Register to see more suggestions
Mendeley helps you to discover research relevant for your work.